RetrogeneDB ID: | retro_btau_1664 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 8:107934771..107935053(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | BT.30804 | ||
| Ensembl ID: | ENSBTAG00000009200 | ||
| Aliases: | PAM16, Magmas, TIMM16 | ||
| Description: | mitochondrial import inner membrane translocase subunit TIM16 [Source:RefSeq peptide;Acc:NP_001002893] |
| Percent Identity: | 53.19 % |
| Parental protein coverage: | 75.2 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | SRAAADARGRAGHQSAATSNLSGLSLQEAQQILNVSKLSPEEIQKNYEHLFKVNDKSVGGSFYLQSKVVR |
| SR....AR............L.......A......S...P.EIQK.YEH.FKVND.S.GGSFYLQSKVVR | |
| Retrocopy | SRSWQPARQQPAPRDMPDTSLQLPPASPASAYRRHSRFCPKEIQKSYEHVFKVNDRSIGGSFYLQSKVVR |
| Parental | AKERLEEELRIQAQEDRERQQPPK |
| AKER.EEELRIQ..EDRER....K | |
| Retrocopy | AKERPEEELRIQVPEDRERAATQK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 1 .80 RPM |
| ERP005899_muscle | 0 .00 RPM | 14 .62 RPM |
| SRP017611_brain | 0 .00 RPM | 7 .45 RPM |
| SRP017611_kidney | 0 .00 RPM | 12 .03 RPM |
| SRP017611_liver | 0 .00 RPM | 6 .72 RPM |
| SRP030211_testis | 0 .00 RPM | 52 .08 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009200 | 1 retrocopy |
retro_btau_1664 ,
|
| Canis familiaris | ENSCAFG00000019226 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019772 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010921 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000014888 | 1 retrocopy | |
| Equus caballus | ENSECAG00000019387 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000007432 | 7 retrocopies | |
| Echinops telfairi | ENSETEG00000006416 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027971 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000008921 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000014301 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000004608 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007947 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000003461 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001347 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009306 | 1 retrocopy |