RetrogeneDB ID: | retro_fcat_520 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | B1:28564705..28565073(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PAM16 | ||
| Ensembl ID: | ENSFCAG00000027971 | ||
| Aliases: | None | ||
| Description: | presequence translocase-associated motor 16 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:29679] |
| Percent Identity: | 89.68 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MAKYLAQIIVMGVQVVGRAFARALRQEFAASR-AAADARGRAGHQSAAASNLSGLSLQEAQQILNVSKLS |
| MAKYLAQIIVMGVQVVGRAFARALRQEFAA...AA.DARGRAGHQSAAASNL.GLSLQEAQQILNVSKLS | |
| Retrocopy | MAKYLAQIIVMGVQVVGRAFARALRQEFAAGQ<AA-DARGRAGHQSAAASNLCGLSLQEAQQILNVSKLS |
| Parental | PEEIQKNYEHLFKVNDKSVGGSFYLQSKVVRARERLQEELRIQAQEDREKEQMPKT |
| .EEIQKNYEH.F.VNDKSVGG.FYLQSKVVRARERLQE.LRI.AQEDRE.E.MPKT | |
| Retrocopy | TEEIQKNYEHVFEVNDKSVGGCFYLQSKVVRARERLQEDLRI*AQEDRE-ERMPKT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 9 .76 RPM |
| SRP017611_kidney | 0 .00 RPM | 12 .88 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .05 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009200 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000019226 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019772 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010921 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000014888 | 1 retrocopy | |
| Equus caballus | ENSECAG00000019387 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000007432 | 7 retrocopies | |
| Echinops telfairi | ENSETEG00000006416 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027971 | 1 retrocopy |
retro_fcat_520 ,
|
| Myotis lucifugus | ENSMLUG00000008921 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000014301 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000004608 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007947 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000003461 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001347 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009306 | 1 retrocopy |