RetrogeneDB ID: | retro_eeur_375 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_275110:7845..8165(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | UBE2C | ||
| Ensembl ID: | ENSEEUG00000010643 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2C [Source:HGNC Symbol;Acc:15937] |
| Percent Identity: | 89.81 % |
| Parental protein coverage: | 59.78 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | VYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWSALYDVRTILLSIQS-LLGE |
| VYED.R.KLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICL.ILKDKWSALYDVRTILLSIQ..LLGE | |
| Retrocopy | VYEDVR*KLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLNILKDKWSALYDVRTILLSIQT<LLGE |
| Parental | PNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVASQEP |
| .NI.SPLNTHAAELWKN.TAFKKYLQET.SK.V.SQEP | |
| Retrocopy | SNISSPLNTHAAELWKNSTAFKKYLQET*SKRVSSQEP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 0 .32 RPM |
| SRP017611_kidney | 0 .00 RPM | 0 .19 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .16 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016746 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000009745 | 6 retrocopies | |
| Equus caballus | ENSECAG00000014619 | 2 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000010643 | 14 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000011886 | 1 retrocopy | |
| Felis catus | ENSFCAG00000001885 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000003164 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000007177 | 14 retrocopies | |
| Microcebus murinus | ENSMICG00000011218 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000021023 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000013661 | 6 retrocopies | |
| Mustela putorius furo | ENSMPUG00000017619 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000012176 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000004989 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000013564 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007423 | 1 retrocopy |