RetrogeneDB ID: | retro_ecab_316 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 14:57106086..57106422(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | UBE2C | ||
| Ensembl ID: | ENSECAG00000014619 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2C [Source:HGNC Symbol;Acc:15937] |
| Percent Identity: | 63.56 % |
| Parental protein coverage: | 64.25 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 3 |
| Parental | NLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDT-QGNICLDILKDKWSALY |
| NLFKWV.TI.GA..TV.EDLRY.LS..F.SG.......VK..T..YHP.VDT.QG..CLDIL.DK..AL. | |
| Retrocopy | NLFKWVRTIRGAPRTVCEDLRY-LS-KFSSGSCHSTLVVKLFTSGYHPQVDT<QGHVCLDILEDKS*ALC |
| Parental | DVRTILLSIQSLLGEPNIDSPLNTHAAELWKN-PT-AFKKYLQETYSK |
| DV.TIL.S.Q.LLGE.NI.SPLNTHAA..WK..PT..FKKYLQE.Y.. | |
| Retrocopy | DVTTILPSVQRLLGELNIHSPLNTHAAKFWKH<PT<TFKKYLQEIYTE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .18 RPM | 0 .06 RPM |
| SRP021940_cerebellum | 0 .10 RPM | 0 .16 RPM |
| SRP021940_embryo | 0 .03 RPM | 66 .05 RPM |
| SRP021940_placental_villous | 0 .14 RPM | 5 .73 RPM |
| SRP021940_synovial_membrane | 0 .11 RPM | 8 .15 RPM |
| SRP021940_testis | 0 .00 RPM | 22 .19 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016746 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000009745 | 6 retrocopies | |
| Equus caballus | ENSECAG00000014619 | 2 retrocopies |
retro_ecab_297, retro_ecab_316 ,
|
| Erinaceus europaeus | ENSEEUG00000010643 | 14 retrocopies | |
| Felis catus | ENSFCAG00000001885 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000003164 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000007177 | 14 retrocopies | |
| Microcebus murinus | ENSMICG00000011218 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000021023 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000013661 | 6 retrocopies | |
| Mustela putorius furo | ENSMPUG00000017619 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000012176 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000004989 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000013564 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007423 | 1 retrocopy |