RetrogeneDB ID: | retro_dnov_140 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_2016:238021..238366(-) | ||
| Located in intron of: | ENSDNOG00000006122 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MAGOHB | ||
| Ensembl ID: | ENSDNOG00000005997 | ||
| Aliases: | None | ||
| Description: | mago-nashi homolog B (Drosophila) [Source:HGNC Symbol;Acc:25504] |
| Percent Identity: | 92.17 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MSMASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRXXXXXHKSVMEELKRIIDDSE |
| MSMASDFYLRYYVG.KGKFGHEFLEF.FRPDGKLRYAN.SNYKNDVMIR.....HKSVMEELKRIIDDSE | |
| Retrocopy | MSMASDFYLRYYVGRKGKFGHEFLEFKFRPDGKLRYANSSNYKNDVMIRKEAYVHKSVMEELKRIIDDSE |
| Parental | ITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQS |
| ITKEDDALWPPPDRVGRQELEIVIG.EHISFTTSKIGSLIDVNQS | |
| Retrocopy | ITKEDDALWPPPDRVGRQELEIVIGEEHISFTTSKIGSLIDVNQS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 4 .67 RPM | 9 .33 RPM |
| SRP012922_cerebellum | 3 .30 RPM | 7 .42 RPM |
| SRP012922_heart | 2 .78 RPM | 5 .57 RPM |
| SRP012922_kidney | 3 .56 RPM | 7 .12 RPM |
| SRP012922_liver | 2 .48 RPM | 3 .87 RPM |
| SRP012922_lung | 5 .19 RPM | 7 .79 RPM |
| SRP012922_quadricep_muscle | 2 .25 RPM | 3 .81 RPM |
| SRP012922_spleen | 4 .12 RPM | 8 .01 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019235 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000004382 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000021662 | 7 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000005997 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000016591 | 3 retrocopies | |
| Homo sapiens | ENSG00000111196 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000001782 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003527 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000005082 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000462 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000003355 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000000548 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000004679 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000000635 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000835 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014820 | 7 retrocopies | |
| Tarsius syrichta | ENSTSYG00000010452 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001272 | 2 retrocopies |