RetrogeneDB ID: | retro_mluc_1039 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL429789:11170961..11171188(-) | ||
| Located in intron of: | ENSMLUG00000012148 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MAGOHB | ||
| Ensembl ID: | ENSMLUG00000003527 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 76.25 % |
| Parental protein coverage: | 53.38 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | RPDGKLRYANNSNYKNDVMIRKEAYVHK-SVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDE |
| .P.GKLRYAN.SNYKN.VMIRKEAYVHK.SVMEELKRI...SEITKE.D.....P.RVG.QELE..IGDE | |
| Retrocopy | QPNGKLRYANDSNYKN-VMIRKEAYVHK<SVMEELKRIA-ESEITKENDVV-ASPNRVGWQELEFIIGDE |
| Parental | HISFTTSKIG |
| H.SFTTSKIG | |
| Retrocopy | HNSFTTSKIG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019235 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000004382 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000005997 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000016591 | 3 retrocopies | |
| Macropus eugenii | ENSMEUG00000001782 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000002444 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003527 | 2 retrocopies |
retro_mluc_1039 , retro_mluc_2484,
|
| Macaca mulatta | ENSMMUG00000005082 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000462 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000000548 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000000635 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000001272 | 2 retrocopies |