RetrogeneDB ID: | retro_chof_1730 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_3705:14815..15042(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MAGOHB | ||
| Ensembl ID: | ENSCHOG00000004382 | ||
| Aliases: | None | ||
| Description: | mago-nashi homolog B (Drosophila) [Source:HGNC Symbol;Acc:25504] |
| Percent Identity: | 63.64 % |
| Parental protein coverage: | 50.68 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | YVGHKGKFGHEFLEF-EFRPDGKLRYANNSNYKNDVMIRKEAY-VHKSVMEELKRIIDDSEITKEDDALW |
| .VGHKGK..HEFLE..EF.P..K.RYANNS..K......K......KSVMEELKR.ID.SEITKED.ALW | |
| Retrocopy | HVGHKGKLSHEFLEL<EFQPNWKFRYANNSYCKK*CHDQKRGLCI*KSVMEELKRKIDESEITKEDGALW |
| Parental | PPPDRVG |
| PPPD..G | |
| Retrocopy | PPPDQAG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019235 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000004382 | 1 retrocopy |
retro_chof_1730 ,
|
| Callithrix jacchus | ENSCJAG00000021662 | 7 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000005997 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000016591 | 3 retrocopies | |
| Homo sapiens | ENSG00000111196 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000001782 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003527 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000005082 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000462 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000003355 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000000548 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000004679 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000000635 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000835 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014820 | 7 retrocopies | |
| Tarsius syrichta | ENSTSYG00000010452 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001272 | 2 retrocopies |