RetrogeneDB ID: | retro_tbel_451 | ||
Retrocopylocation | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | GeneScaffold_211:279663..279911(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MAGOHB | ||
| Ensembl ID: | ENSTBEG00000014820 | ||
| Aliases: | None | ||
| Description: | mago-nashi homolog B (Drosophila) [Source:HGNC Symbol;Acc:25504] |
| Percent Identity: | 96.43 % |
| Parental protein coverage: | 72.81 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | DFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKED |
| DFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEEL.RIIDDSEITKED | |
| Retrocopy | DFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELRRIIDDSEITKED |
| Parental | DAL-WPPPDRVGRQ |
| DAL..PPPDRVGRQ | |
| Retrocopy | DAL<EPPPDRVGRQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004382 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000021662 | 7 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000005997 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000016591 | 3 retrocopies | |
| Homo sapiens | ENSG00000111196 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000001782 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005082 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000462 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000003355 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000000548 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000004679 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000000835 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011611 | 17 retrocopies | |
| Tupaia belangeri | ENSTBEG00000014820 | 7 retrocopies |
retro_tbel_1250, retro_tbel_1393, retro_tbel_210, retro_tbel_2259, retro_tbel_2723, retro_tbel_2878, retro_tbel_451 ,
|
| Tarsius syrichta | ENSTSYG00000010452 | 7 retrocopies |