RetrogeneDB ID: | retro_rnor_2996 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | X:150806178..150806633(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Dppa4 | ||
| Ensembl ID: | ENSRNOG00000025404 | ||
| Aliases: | None | ||
| Description: | Developmental pluripotency-associated protein 4 [Source:UniProtKB/Swiss-Prot;Acc:D3Z8Y2] |
| Percent Identity: | 75.16 % |
| Parental protein coverage: | 53.52 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | KTEPGEESQVTVPLEIVTVPEEQIPALVDPPVLYEEVSTTVVTTSASEAVLASWARIAANAKKLEAVPSN |
| KTE..EES.VTVPLEI.T.PEE...AL.DPP.LYEE.ST.VVT..ASEAVL.SW.RIAANA.K.EA..SN | |
| Retrocopy | KTESREES*VTVPLEIITMPEEEMCALIDPPMLYEEFSTMVVTRCASEAVLVSWSRIAANARKFEAMTSN |
| Parental | ATSETYGEMWCVVHGTSLPATSSGWVRLQFHAGQA-WVPDKKGKAIALFLLPACTFPPPHLEDNMLCPKC |
| A.SETYGEMWCVVH.TSL..TSS.WV.LQFHAGQA...P.KKGKAIALFL..ACTFPP.HLEDNMLCPK. | |
| Retrocopy | AVSETYGEMWCVVHETSLSVTSSDWVQLQFHAGQA<LAPHKKGKAIALFLFRACTFPPQHLEDNMLCPKY |
| Parental | VHKNKILTKSLEG |
| V..NK.LT.SLEG | |
| Retrocopy | VPRNKVLTESLEG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 0 .00 RPM |
| SRP017611_kidney | 0 .00 RPM | 0 .21 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .13 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000010335 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020171 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000002722 | 1 retrocopy | |
| Homo sapiens | ENSG00000121570 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015121 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000016804 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016423 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016901 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000018083 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000010206 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000058550 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004030 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016435 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000013565 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000015200 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000010677 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000025404 | 4 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000017398 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009508 | 1 retrocopy |