RetrogeneDB ID: | retro_rnor_2565 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 8:47681595..47681813(+) | ||
| Located in intron of: | ENSRNOG00000013843 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rpl34 | ||
| Ensembl ID: | ENSRNOG00000016387 | ||
| Aliases: | Rpl34, Rpl34l2 | ||
| Description: | 60S ribosomal protein L34 [Source:RefSeq peptide;Acc:NP_001102037] |
| Percent Identity: | 79.49 % |
| Parental protein coverage: | 66.38 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | VQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVG-KAPKSACGVCPGRLRGVRAVRPKVLMRLSKT |
| VQ.LTY.RRLSYNTASNKTRLSRTPGN......T...G.KAPKSAC.VCPGRLRGVRAVRPKVLMRLSK. | |
| Retrocopy | VQHLTYGRRLSYNTASNKTRLSRTPGN----TFTPRLG<KAPKSACSVCPGRLRGVRAVRPKVLMRLSKR |
| Parental | KKHQQGLW |
| KK.QQGL. | |
| Retrocopy | KKRQQGLY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 49 .11 RPM |
| SRP017611_kidney | 0 .00 RPM | 73 .69 RPM |
| SRP017611_liver | 0 .00 RPM | 44 .58 RPM |