RetrogeneDB ID: | retro_mmus_823 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 11:84810592..84810799(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rpl34 | ||
| Ensembl ID: | ENSMUSG00000062006 | ||
| Aliases: | Rpl34, 1100001I22Rik | ||
| Description: | ribosomal protein L34 [Source:MGI Symbol;Acc:MGI:1915686] |
| Percent Identity: | 52.11 % |
| Parental protein coverage: | 59.83 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MVQRLTYRRRLSYNTASNKTRLSRTP-GNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSK |
| M..R..Y..RL....A.NK..LS.T..G.RIVY...KKVGKAP.....V.PGRL.G...V..KVL.RLS. | |
| Retrocopy | MILRWAYHYRLTFSAAGNKIKLSCTLLGIRIVYI--KKVGKAPQTLGSVLPGRLQGTPSV*TKVLKRLST |
| Parental | T |
| T | |
| Retrocopy | T |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 41 .14 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 24 .40 RPM |
| SRP007412_heart | 0 .00 RPM | 40 .38 RPM |
| SRP007412_kidney | 0 .00 RPM | 42 .08 RPM |
| SRP007412_liver | 0 .00 RPM | 45 .41 RPM |
| SRP007412_testis | 0 .05 RPM | 39 .75 RPM |