RetrogeneDB ID: | retro_rnor_1040 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 14:29784659..29784891(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SUB1 | ||
| Ensembl ID: | ENSRNOG00000050563 | ||
| Aliases: | Sub1, Rpo2tc1 | ||
| Description: | Activated RNA polymerase II transcriptional coactivator p15 [Source:UniProtKB/Swiss-Prot;Acc:Q63396] |
| Percent Identity: | 62.5 % |
| Parental protein coverage: | 61.42 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | SSSSGSDSDSEV-EKKLKRKKQVVPEKPVKKQK-PGESSRALASSKQSSSSRDDNMFQIGKMRYVSVRDF |
| S...GS.SDS...EKKLKRK.QVVP.KPV.KQ..P.E.SR...SS.Q..SSRDDNMF..GK.R.VS...F | |
| Retrocopy | SNFTGSASDSKIGEKKLKRKLQVVPKKPV-KQN>PSETSRTFRSSMQ*-SSRDDNMFLNGKTRLVSDHCF |
| Parental | KGKILIDIRE |
| K..ILI.IRE | |
| Retrocopy | KASILIGIRE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 249 .70 RPM |
| SRP017611_kidney | 0 .00 RPM | 67 .90 RPM |
| SRP017611_liver | 0 .00 RPM | 35 .90 RPM |