RetrogeneDB ID: | retro_ptro_648 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 11:121106113..121106565(-) | ||
| Located in intron of: | ENSPTRG00000004405 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FUNDC1 | ||
| Ensembl ID: | ENSPTRG00000021821 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 86.18 % |
| Parental protein coverage: | 97.42 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | NPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKL |
| NP.PQ.YES.DDSYEVLDLTEYARRHQWWN.VFGHSSG.MVEKY.VATQIVMGGV.GW.AGFLFQKV.KL | |
| Retrocopy | NPAPQEYESEDDSYEVLDLTEYARRHQWWNPVFGHSSGSMVEKYAVATQIVMGGVPGWFAGFLFQKV*KL |
| Parental | AATAVGGGFLLL-QIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISS |
| AATAVGG.FL...QIASHSGYVQI.WKRVEKD.NKAKRQ.KKRANKAAPEINNLIEEA.EFIKQ.IVI.. | |
| Retrocopy | AATAVGGDFLAV<QIASHSGYVQINWKRVEKDANKAKRQMKKRANKAAPEINNLIEEAIEFIKQHIVIPG |
| Parental | GFVGGFLLGLAS |
| .FVGGFLLGLAS | |
| Retrocopy | RFVGGFLLGLAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 10 .08 RPM |
| SRP007412_cerebellum | 0 .07 RPM | 12 .62 RPM |
| SRP007412_heart | 0 .00 RPM | 13 .32 RPM |
| SRP007412_kidney | 0 .00 RPM | 9 .65 RPM |
| SRP007412_liver | 0 .00 RPM | 4 .26 RPM |
| SRP007412_testis | 0 .00 RPM | 7 .27 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000010876 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012962 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000012763 | 3 retrocopies | |
| Homo sapiens | ENSG00000069509 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000023311 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000010215 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006795 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000000450 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000003505 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000021088 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000002513 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000029753 | 5 retrocopies | |
| Pongo abelii | ENSPPYG00000020268 | 2 retrocopies | |
| Pelodiscus sinensis | ENSPSIG00000013793 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021821 | 1 retrocopy |
retro_ptro_648 ,
|
| Pan troglodytes | ENSPTRG00000041852 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000003470 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000000501 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009139 | 1 retrocopy |