RetrogeneDB ID: | retro_ptro_2867 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 9:2915186..2915423(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP5H | ||
| Ensembl ID: | ENSPTRG00000009628 | ||
| Aliases: | None | ||
| Description: | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d [Source:UniProtKB/TrEMBL;Acc:K7AG29] |
| Percent Identity: | 83.54 % |
| Parental protein coverage: | 51.97 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | EDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPY |
| EDKYTAQ.D.EEKEDVKSCAEWVSLSKA..VEYEK..EKMKNLIPFDQMTIEDL...FPETKLDKKKYP. | |
| Retrocopy | EDKYTAQLDSEEKEDVKSCAEWVSLSKAGTVEYEKQKEKMKNLIPFDQMTIEDLKKTFPETKLDKKKYP* |
| Parental | WPHQPIENL |
| .PHQPI..L | |
| Retrocopy | *PHQPIKDL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 80 .02 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 93 .67 RPM |
| SRP007412_heart | 0 .03 RPM | 269 .08 RPM |
| SRP007412_kidney | 0 .05 RPM | 154 .43 RPM |
| SRP007412_liver | 0 .10 RPM | 110 .94 RPM |
| SRP007412_testis | 0 .11 RPM | 77 .35 RPM |