RetrogeneDB ID: | retro_dnov_412 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_4490:417289..417526(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP5H | ||
| Ensembl ID: | ENSDNOG00000006913 | ||
| Aliases: | None | ||
| Description: | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d [Source:HGNC Symbol;Acc:845] |
| Percent Identity: | 93.67 % |
| Parental protein coverage: | 51.97 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | VDKYTALVDAEEKEDVKSCAEFLNLSKARIEEYEKLLEKMRNIIPFDQMTIEDLNEAFPETKLDKTKYPY |
| VDKYTALVDAEEKEDVKS..EFLNLSKARIEEYEKLLEKMRNIIPFDQM.IEDLN.A.PETKLDKTKYPY | |
| Retrocopy | VDKYTALVDAEEKEDVKSRTEFLNLSKARIEEYEKLLEKMRNIIPFDQMSIEDLNDAVPETKLDKTKYPY |
| Parental | WPHQPIENL |
| WPHQPIENL | |
| Retrocopy | WPHQPIENL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 34 .03 RPM | 129 .13 RPM |
| SRP012922_cerebellum | 18 .01 RPM | 75 .47 RPM |
| SRP012922_heart | 52 .44 RPM | 252 .91 RPM |
| SRP012922_kidney | 31 .49 RPM | 137 .17 RPM |
| SRP012922_liver | 9 .44 RPM | 44 .58 RPM |
| SRP012922_lung | 11 .30 RPM | 56 .05 RPM |
| SRP012922_quadricep_muscle | 48 .98 RPM | 190 .91 RPM |
| SRP012922_spleen | 13 .51 RPM | 51 .05 RPM |