RetrogeneDB ID: | retro_ptro_2120 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 5:545146..545395(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FAM136A | ||
| Ensembl ID: | ENSPTRG00000012030 | ||
| Aliases: | None | ||
| Description: | family with sequence similarity 136, member A [Source:HGNC Symbol;Acc:25911] |
| Percent Identity: | 63.86 % |
| Parental protein coverage: | 60.14 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | VQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTSELEKFQDR |
| VQEA..SMVK........KMQGLM..CS.S.CEDS...M.QVH.....CHVPLAQAQALVT.ELEK.QDR | |
| Retrocopy | VQEAADSMVKNWRERELQKMQGLMIWCSTSYCEDSRVPMQQVHPGLQHCHVPLAQAQALVTGELEKSQDR |
| Parental | LARCTMHCNDKAK |
| L...T.HCNDKA. | |
| Retrocopy | LTGGTRHCNDKAR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 15 .39 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 14 .77 RPM |
| SRP007412_heart | 0 .00 RPM | 10 .43 RPM |
| SRP007412_kidney | 0 .03 RPM | 19 .61 RPM |
| SRP007412_liver | 0 .00 RPM | 19 .08 RPM |
| SRP007412_testis | 0 .00 RPM | 5 .69 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3136 |
| Gorilla gorilla | retro_ggor_1361 |
| Pongo abelii | retro_pabe_2618 |