RetrogeneDB ID: | retro_pabe_2301 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 3:36511165..36511514(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CDV3 | ||
| Ensembl ID: | ENSPPYG00000025898 | ||
| Aliases: | None | ||
| Description: | CDV3 homolog (mouse) [Source:HGNC Symbol;Acc:26928] |
| Percent Identity: | 57.85 % |
| Parental protein coverage: | 55.05 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | GGGAGAGTRPGDGGTASAGAAGPGAATKAVTKHEDEWKEIKQKEVDYSGLRVQAMQISSEKEEDDNE-KR |
| GGG.GAG...G.GGTASA.AAGP.....A.TK......E.K..E......R....Q.....E......KR | |
| Retrocopy | GGGGGAGAWLGEGGTASAEAAGPAG---ATTKAVKDEGEWKGLE*KEVDYRGLGVQAMQISEKEEDI>KR |
| Parental | QDPGDNWEEGGGGGGGMEKSSGPWNKTAPVQAPPCSILVTETPEPAMTSGV |
| QDPGDNWEEGGGGG...EKSSGPWNKTAPVQAP.....VTETPE.AMTSGV | |
| Retrocopy | QDPGDNWEEGGGGGD-TEKSSGPWNKTAPVQAPLAPVIVTETPELAMTSGV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 2 .49 RPM | 12 .39 RPM |
| SRP007412_cerebellum | 0 .61 RPM | 6 .81 RPM |
| SRP007412_heart | 2 .32 RPM | 16 .05 RPM |
| SRP007412_kidney | 2 .25 RPM | 14 .58 RPM |
| SRP007412_liver | 1 .96 RPM | 13 .74 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000035556 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000008963 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002998 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010208 | 5 retrocopies | |
| Equus caballus | ENSECAG00000015689 | 2 retrocopies | |
| Homo sapiens | ENSG00000091527 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027821 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000009864 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032803 | 10 retrocopies | |
| Ochotona princeps | ENSOPRG00000003600 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000025898 | 1 retrocopy |
retro_pabe_2301 ,
|
| Pan troglodytes | ENSPTRG00000015409 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011637 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014910 | 5 retrocopies |