RetrogeneDB ID: | retro_ecab_444 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 18:19662901..19663286(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSECAG00000007662 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CDV3 | ||
| Ensembl ID: | ENSECAG00000015689 | ||
| Aliases: | None | ||
| Description: | CDV3 homolog (mouse) [Source:HGNC Symbol;Acc:26928] |
| Percent Identity: | 79.84 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | GGGVEKSSGPWNKTAPVQAPPAPGIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPSLQS |
| GGGVEKSSGP.NKTAP.QAP.APG.VTETP.PAMTS..YRPPGARLTTTR...QGPPEI.SDTQFPSLQ. | |
| Retrocopy | GGGVEKSSGPCNKTAPGQAPLAPGTVTETPNPAMTSDLYRPPGARLTTTREKTQGPPEIDSDTQFPSLQP |
| Parental | TAKHVESRKDKGMQKSFE-VVRHRTRRRDEVSGSQAPTLQLDNRCAVLGGQRSSCAQSS |
| TAKHV.SRKDK.M.KS.E.VVRH..R.RDE.S.SQA..LQLDNRCAVL.GQRSS.AQSS | |
| Retrocopy | TAKHVGSRKDKEMEKSSE>VVRHGMRHRDELSKSQALKLQLDNRCAVLEGQRSSRAQSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 11 .45 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 12 .72 RPM |
| SRP021940_embryo | 0 .13 RPM | 24 .55 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 15 .64 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 17 .73 RPM |
| SRP021940_testis | 0 .06 RPM | 73 .28 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000035556 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000008963 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002998 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010208 | 5 retrocopies | |
| Equus caballus | ENSECAG00000015689 | 2 retrocopies |
retro_ecab_444 , retro_ecab_636,
|
| Homo sapiens | ENSG00000091527 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027821 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032803 | 10 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003470 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000012748 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000003600 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000025898 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015409 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011637 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014910 | 5 retrocopies |