RetrogeneDB ID: | retro_ogar_1312 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873542.1:7757372..7757772(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSOGAG00000025488 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FABP3 | ||
| Ensembl ID: | ENSOGAG00000013757 | ||
| Aliases: | None | ||
| Description: | fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) [Source:HGNC Symbol;Acc:3557] |
| Percent Identity: | 81.34 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MVDAFVGTWKLVDSKNFDDYMKSIGVGFATRQVANMTKPTTIIEKNGDTITLRTQSTFKNTEISFKLGVE |
| MVDAF..TWKLVD.KNF.DYMKSIGVGF.TRQVANMTKPTT.I.KN.DTI.L.TQSTFKNTE.SFK.GV. | |
| Retrocopy | MVDAFLATWKLVDNKNFNDYMKSIGVGFSTRQVANMTKPTTVIKKNRDTIILKTQSTFKNTETSFKVGVV |
| Parental | FDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELSDGKLILTLTHGSVVCTRT-YEKEA |
| .DET.ADDRKVKS.VTLDG.KL.HLQKWDGQET.LVRELSDGK.ILTLTH..VVCT.T..EKEA | |
| Retrocopy | VDETAADDRKVKSTVTLDGDKLIHLQKWDGQETALVRELSDGKFILTLTHSTVVCTPT>NEKEA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016819 | 2 retrocopies | |
| Danio rerio | ENSDARG00000023290 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000000511 | 2 retrocopies | |
| Equus caballus | ENSECAG00000024852 | 1 retrocopy | |
| Homo sapiens | ENSG00000121769 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000014432 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012501 | 6 retrocopies | |
| Microcebus murinus | ENSMICG00000009359 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013609 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000028773 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001586 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000002413 | 10 retrocopies | |
| Otolemur garnettii | ENSOGAG00000012166 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013757 | 4 retrocopies | |
| Otolemur garnettii | ENSOGAG00000031110 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000001616 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000000457 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012879 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003842 | 3 retrocopies |