RetrogeneDB ID: | retro_mmus_65 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 10:86731986..86732388(-) | ||
| Located in intron of: | ENSMUSG00000044937 | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000056366 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Fabp3 | ||
| Ensembl ID: | ENSMUSG00000028773 | ||
| Aliases: | None | ||
| Description: | fatty acid binding protein 3, muscle and heart [Source:MGI Symbol;Acc:MGI:95476] |
| Percent Identity: | 98.5 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEINFQLGIE |
| MADAFVGTWKLVD.KNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEINFQLGIE | |
| Retrocopy | MADAFVGTWKLVDCKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEINFQLGIE |
| Parental | FDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVDGKLILTLTHGSVVSTRTYEKEA |
| FDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVD.KLILTLTHGSVVSTRTYEKEA | |
| Retrocopy | FDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVDRKLILTLTHGSVVSTRTYEKEA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .21 RPM | 17 .38 RPM |
| SRP007412_cerebellum | 0 .17 RPM | 14 .24 RPM |
| SRP007412_heart | 11 .05 RPM | 1238 .89 RPM |
| SRP007412_kidney | 1 .58 RPM | 279 .45 RPM |
| SRP007412_liver | 0 .03 RPM | 0 .05 RPM |
| SRP007412_testis | 0 .87 RPM | 24 .79 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_6858 | 867 libraries | 142 libraries | 55 libraries | 1 library | 7 libraries |

| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016819 | 2 retrocopies | |
| Danio rerio | ENSDARG00000023290 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000000511 | 2 retrocopies | |
| Equus caballus | ENSECAG00000024852 | 1 retrocopy | |
| Homo sapiens | ENSG00000121769 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000014432 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012501 | 6 retrocopies | |
| Microcebus murinus | ENSMICG00000009359 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013609 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000027533 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000028773 | 3 retrocopies |
retro_mmus_2804, retro_mmus_3204, retro_mmus_65 ,
|
| Nomascus leucogenys | ENSNLEG00000001586 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013757 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000001616 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000000457 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012879 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003842 | 3 retrocopies |