RetrogeneDB ID: | retro_dnov_1510 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_2207:115730..116038(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FABP3 | ||
| Ensembl ID: | ENSDNOG00000000511 | ||
| Aliases: | None | ||
| Description: | fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) [Source:HGNC Symbol;Acc:3557] |
| Percent Identity: | 57.41 % |
| Parental protein coverage: | 99.07 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | VGFAIRQVGAMTKPFTIIEQ-NGDTITIKTQSTFKSTEISFQLGVEFDETTADDRKVKSIVTLDGGKLVH |
| ..FA..QV.AMTK..TII...NGD.I..K.QSTFK..EIS....V.FDETTA.DRKV...VT..GG...H | |
| Retrocopy | IDFATGQVAAMTKTTTIIGK<NGDSINTKVQSTFKNMEISIKVSV*FDETTAGDRKVNRTVTFEGGNF-H |
| Parental | VQKWNGQETTLVRELKDGKLILTLTLGNVVSTRIYEKE |
| V.KW..QE...V.EL..GKLIL.LT.G...STR.Y.KE | |
| Retrocopy | V*KWDRQEMAFVQELNHGKLILILTCG---STRTY*KE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 29 .17 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 18 .15 RPM |
| SRP012922_heart | 0 .00 RPM | 761 .99 RPM |
| SRP012922_kidney | 0 .27 RPM | 47 .64 RPM |
| SRP012922_liver | 0 .00 RPM | 0 .15 RPM |
| SRP012922_lung | 0 .00 RPM | 7 .94 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 656 .68 RPM |
| SRP012922_spleen | 0 .00 RPM | 0 .92 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016819 | 2 retrocopies | |
| Danio rerio | ENSDARG00000023290 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000000511 | 2 retrocopies |
retro_dnov_1510 , retro_dnov_2482,
|
| Dasypus novemcinctus | ENSDNOG00000018066 | 5 retrocopies | |
| Equus caballus | ENSECAG00000024852 | 1 retrocopy | |
| Homo sapiens | ENSG00000121769 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000014432 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012501 | 6 retrocopies | |
| Microcebus murinus | ENSMICG00000009359 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013609 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000028773 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000001586 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013757 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000001616 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000000457 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012879 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003842 | 3 retrocopies |