RetrogeneDB ID: | retro_ogar_2821 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873667.1:3200991..3201211(-) | ||
| Located in intron of: | ENSOGAG00000001296 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FABP7 | ||
| Ensembl ID: | ENSOGAG00000031110 | ||
| Aliases: | None | ||
| Description: | fatty acid binding protein 7, brain [Source:HGNC Symbol;Acc:3562] |
| Percent Identity: | 67.57 % |
| Parental protein coverage: | 55.3 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | KNTEISFHLGEEFDETTADDRNCKSV-VSLDGDKLVHVQKWDGKETNFVREIKDGKMVMTLTFGDVVAVR |
| K....SF..GEEFDE.TADDRNCKSV..........HV.K.DG.ETNFVREIKDG.MVMTL.FG.VVAV. | |
| Retrocopy | KIAQNSFQMGEEFDESTADDRNCKSV>AWMETNLFIHV*KQDGQETNFVREIKDGNMVMTLSFGHVVAVC |
| Parental | HYEK |
| HYEK | |
| Retrocopy | HYEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000014056 | 1 retrocopy | |
| Homo sapiens | ENSG00000164434 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025475 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000021907 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000001497 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000002413 | 10 retrocopies | |
| Otolemur garnettii | ENSOGAG00000012166 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013757 | 4 retrocopies | |
| Otolemur garnettii | ENSOGAG00000031110 | 1 retrocopy |
retro_ogar_2821 ,
|
| Ochotona princeps | ENSOPRG00000000992 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016979 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000018564 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000003313 | 1 retrocopy |