RetrogeneDB ID: | retro_ptro_402 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 1:223021870..223022123(-) | ||
| Located in intron of: | ENSPTRG00000002174 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FABP7 | ||
| Ensembl ID: | ENSPTRG00000018564 | ||
| Aliases: | None | ||
| Description: | fatty acid binding protein 7, brain [Source:HGNC Symbol;Acc:3562] |
| Percent Identity: | 71.76 % |
| Parental protein coverage: | 63.64 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTL |
| KVV.R..S.FKNTE.SF.LGEEFDETT.DDRNCK.VVSLD.DKL.HIQKWD.KET.F.REIK.G..VMT. | |
| Retrocopy | KVVMRIQSMFKNTEVSFHLGEEFDETTTDDRNCKFVVSLDRDKLIHIQKWDDKETYFIREIKYGEVVMTY |
| Parental | TF-GDVVAVRHYEKA |
| ....DVVAV.HY.K. | |
| Retrocopy | FW>DDVVAVYHYKKS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .32 RPM | 19 .36 RPM |
| SRP007412_cerebellum | 0 .14 RPM | 31 .69 RPM |
| SRP007412_heart | 0 .06 RPM | 0 .06 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .42 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .88 RPM |
| SRP007412_testis | 0 .11 RPM | 0 .53 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_536 |
| Gorilla gorilla | retro_ggor_489 |
| Pongo abelii | retro_pabe_213 |
| Macaca mulatta | retro_mmul_458 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000014056 | 1 retrocopy | |
| Homo sapiens | ENSG00000164434 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025475 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000021907 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000001497 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000031110 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000000992 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016979 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000000457 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000018564 | 1 retrocopy |
retro_ptro_402 ,
|
| Pan troglodytes | ENSPTRG00000020373 | 12 retrocopies | |
| Pan troglodytes | ENSPTRG00000022654 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000003313 | 1 retrocopy |