RetrogeneDB ID: | retro_mputfur_752 | ||
Retrocopy location | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL896944.1:1177819..1178009(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EIF1 | ||
| Ensembl ID: | ENSMPUG00000010883 | ||
| Aliases: | None | ||
| Description: | eukaryotic translation initiation factor 1 [Source:HGNC Symbol;Acc:3249] |
| Percent Identity: | 53.03 % |
| Parental protein coverage: | 56.64 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | IADDYDKKKLVKAFKKKFACNGTVI-EHPEYGEVIQLQGDQ-RKNICQFLVEIGLAKDDQLKVHGF |
| ...DY..K.L.K.FK.K.A.NG....EHPEYGEVI.LQ.D..R....QFL.E.GL.KD.Q.K..G. | |
| Retrocopy | VTNDYKRKNLMKVFKRKPAYNGDAT<EHPEYGEVIPLQADR<RESMHQFLTETGLTKDGQRKLRGW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |