RetrogeneDB ID: | retro_rnor_532 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 1:232056001..232056193(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Eif1 | ||
| Ensembl ID: | ENSRNOG00000033765 | ||
| Aliases: | Eif1, Sui1-rs1 | ||
| Description: | eukaryotic translation initiation factor 1 [Source:RefSeq peptide;Acc:NP_001099307] |
| Percent Identity: | 100.0 % |
| Parental protein coverage: | 56.64 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | IADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLIEIGLAKDDQLKVHGF |
| IADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLIEIGLAKDDQLKVHGF | |
| Retrocopy | IADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLIEIGLAKDDQLKVHGF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 184 .41 RPM |
| SRP017611_kidney | 0 .28 RPM | 169 .01 RPM |
| SRP017611_liver | 0 .00 RPM | 68 .25 RPM |