RetrogeneDB ID: | retro_mmus_3638 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:74771297..74771497(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Eif1 | ||
| Ensembl ID: | ENSMUSG00000035530 | ||
| Aliases: | Eif1, Sui1-rs1 | ||
| Description: | eukaryotic translation initiation factor 1 [Source:MGI Symbol;Acc:MGI:105125] |
| Percent Identity: | 60.0 % |
| Parental protein coverage: | 59.29 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | LTTVQGIADDYDKKK-LVKAFKKKFACNGTVIEHPEYG-EVIQLQGDQRKNICQ-FLIEIGLAKDDQLKV |
| L.....IADDY.KK...VKA...KF.CN...IE.PEYG...IQLQGDQ.K..CQ..LIE...AKDDQLKV | |
| Retrocopy | LLLLSKIADDYYKKE>PVKALRGKFSCNSSIIEPPEYG<DAIQLQGDQCKRTCQ<VLIETR*AKDDQLKV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 129 .24 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 91 .10 RPM |
| SRP007412_heart | 0 .00 RPM | 194 .38 RPM |
| SRP007412_kidney | 0 .00 RPM | 123 .04 RPM |
| SRP007412_liver | 0 .00 RPM | 113 .49 RPM |
| SRP007412_testis | 0 .00 RPM | 149 .52 RPM |