RetrogeneDB ID: | retro_mmus_414 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 1:13446453..13446636(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ptma | ||
| Ensembl ID: | ENSMUSG00000026238 | ||
| Aliases: | Ptma, Thym | ||
| Description: | prothymosin alpha [Source:MGI Symbol;Acc:MGI:97803] |
| Percent Identity: | 51.61 % |
| Parental protein coverage: | 53.15 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | DAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEE---NGEQEADNEVDEEEEEGG |
| D...DTSSEITTKDL.EKK.V.EEA.NGR.A..N.N.........G..E.D.E..E..E..G | |
| Retrocopy | DMVLDTSSEITTKDLEEKK-VEEEAKNGRAASGNENGEQGPIVGRGRREEDGEEREGDEDEG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 66 .05 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 120 .54 RPM |
| SRP007412_heart | 0 .00 RPM | 97 .94 RPM |
| SRP007412_kidney | 0 .00 RPM | 233 .71 RPM |
| SRP007412_liver | 0 .00 RPM | 95 .06 RPM |
| SRP007412_testis | 0 .00 RPM | 65 .54 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002549 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000032596 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000013611 | 9 retrocopies | |
| Felis catus | ENSFCAG00000004780 | 1 retrocopy | |
| Homo sapiens | ENSG00000187514 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009874 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000002628 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000012140 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000026238 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000014135 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000018584 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000023690 | 1 retrocopy |