RetrogeneDB ID: | retro_ggor_2149 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 5:6564354..6564650(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ENSG00000197744 | ||
| Ensembl ID: | ENSGGOG00000009874 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 67.0 % |
| Parental protein coverage: | 85.45 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MSDAAVDTSSEITTKDLKEKKEVVEEAE-NGRDAPANGNANEENGEQEADNEVDEEEEEG-GEEEEEEEE |
| MSDAA.DTSSEITTKDLKEKKEVVEEAE.NGRDA.ANGNANEEN.EQE.DNEVDEEEEEG.GEEE...E. | |
| Retrocopy | MSDAAIDTSSEITTKDLKEKKEVVEEAE<NGRDASANGNANEENWEQEVDNEVDEEEEEGDGEEEDGDED |
| Parental | GDGEEEDG----DEDEEAESATGKRAAEDD |
| ...E...G......DE.....T.K.....D | |
| Retrocopy | EEAEFATGK*AAEDDEDDDVDTKKQKIDED |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 176 .71 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 111 .34 RPM |
| SRP007412_heart | 0 .00 RPM | 64 .17 RPM |
| SRP007412_kidney | 0 .08 RPM | 191 .40 RPM |
| SRP007412_liver | 0 .00 RPM | 107 .31 RPM |
| SRP007412_testis | 0 .41 RPM | 113 .86 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1863 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002549 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000032596 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000013611 | 9 retrocopies | |
| Felis catus | ENSFCAG00000004780 | 1 retrocopy | |
| Homo sapiens | ENSG00000187514 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009874 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000002628 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000012140 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000026238 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000014135 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000018584 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000023690 | 1 retrocopy |