RetrogeneDB ID: | retro_mmus_3244 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 9:8476272..8476490(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ndufa3 | ||
| Ensembl ID: | ENSMUSG00000035674 | ||
| Aliases: | Ndufa3, 1010001M12Rik, 1700022J01Rik | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3 [Source:MGI Symbol;Acc:MGI:1913341] |
| Percent Identity: | 72.0 % |
| Parental protein coverage: | 88.1 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KNAWAKEPVLVVSFSVWGLAIIMPMISPYTKYAS-MINKATPYNYPVPVRDDGNMPDVPSHPQDPLGPSL |
| KN.W..E.VLVVSFS.WGL.I.MP..SPYTKYA..MI...TPYNYPVPV.D...MPDVPS.PQ.PLGPSL | |
| Retrocopy | KNTWTNELVLVVSFSIWGLTI-MPIVSPYTKYAG<MISQVTPYNYPVPVQDNEDMPDVPSYPQEPLGPSL |
| Parental | DWLKN |
| .WLKN | |
| Retrocopy | EWLKN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 49 .62 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 51 .80 RPM |
| SRP007412_heart | 0 .00 RPM | 241 .66 RPM |
| SRP007412_kidney | 0 .00 RPM | 93 .84 RPM |
| SRP007412_liver | 0 .00 RPM | 66 .82 RPM |
| SRP007412_testis | 0 .14 RPM | 19 .48 RPM |