RetrogeneDB ID: | retro_ecab_253 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 11:26021685..26021925(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA3 | ||
| Ensembl ID: | ENSECAG00000015897 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa [Source:HGNC Symbol;Acc:7686] |
| Percent Identity: | 75.61 % |
| Parental protein coverage: | 95.24 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | LAAFLKNAWAKEPVLVAS-FTIAGLAIILPILSPYTK-YSIMINKATPYTYPVPLRDDGNMPDVPSHPQD |
| L..FLK.AWAKEP.LV.S.FTI.GLAIIL..LSPYTK...I.IN.ATPY.YPVPL.DDGNM.D.PSHPQ. | |
| Retrocopy | LTTFLKKAWAKEPLLVMS>FTIGGLAIILSPLSPYTK<VAIVINQATPYNYPVPL*DDGNMSDMPSHPQN |
| Parental | PQGPSLEWLKKL |
| PQGPSLEW.KKL | |
| Retrocopy | PQGPSLEWPKKL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 15 .35 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 41 .96 RPM |
| SRP021940_embryo | 0 .00 RPM | 37 .16 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 18 .57 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 18 .89 RPM |
| SRP021940_testis | 0 .00 RPM | 32 .29 RPM |