RetrogeneDB ID: | retro_mmul_803 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 11:45634210..45634612(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.2549 | ||
| Ensembl ID: | ENSMMUG00000013793 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 66.91 % |
| Parental protein coverage: | 74.05 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | SLPPGDPQLIALIVEQLKSRGL-FDSFRRDCLADVDTKPAYQN-LRQKVDNFVSTHLDKQEWNPTMNKNQ |
| .LPPGDP....LI.EQL.SRG..F.SFRR.C.A..D.KPAYQN..RQK....VS.HLDKQEWNPTM.KN. | |
| Retrocopy | ALPPGDPP---LILEQLRSRGP>FGSFRRCCVAPLDPKPAYQN<SRQKAEHSVSVHLDKQEWNPTMRKN* |
| Parental | LRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFLAAQKKAAVPAPPPEPEGQDPPA |
| LR.GLRQSV.Q.G.L.AG.DR..S.V.DP.LNHI.RP..ERA.HE.L.AQK.A.VP.PPPEP..QDPPA | |
| Retrocopy | LRSGLRQSVFQAGTLKAGFDRVLS*VMDPELNHIPRPPVERATHEILGAQKTAMVPVPPPEPKDQDPPA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 5 .38 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 10 .55 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .94 RPM |
| SRP007412_heart | 0 .00 RPM | 8 .19 RPM |
| SRP007412_kidney | 0 .00 RPM | 3 .17 RPM |
| SRP007412_liver | 0 .00 RPM | 2 .69 RPM |
| SRP007412_testis | 0 .19 RPM | 14 .02 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_993 |
| Pan troglodytes | retro_ptro_757 |
| Gorilla gorilla | retro_ggor_794 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000034598 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000016776 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000031971 | 4 retrocopies | |
| Homo sapiens | ENSG00000145919 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010925 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000002626 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013793 | 2 retrocopies |
retro_mmul_803 , retro_mmul_869,
|
| Mus musculus | ENSMUSG00000044502 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000476 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000014283 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001107 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000016057 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000017544 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000013505 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014046 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000007617 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000384 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000004260 | 1 retrocopy |