RetrogeneDB ID: | retro_cfam_1374 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 3:37417529..37417971(-) | ||
| Located in intron of: | ENSCAFG00000010286 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BOD1 | ||
| Ensembl ID: | ENSCAFG00000016776 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 91.33 % |
| Parental protein coverage: | 80.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | PINPASLPPGDPHLIALIVEQLKSRGLFDSFR-RDCLADVDTKPAYQNLRQKVDNFV-STHLDKQEWNPT |
| PI.PASL.PGDP.LI..I.EQLKSRGLFDSF..RDCLADVDTKPA.QNLRQKVDNFV..THLDKQEWNPT | |
| Retrocopy | PISPASLSPGDPQLIPNIAEQLKSRGLFDSFP<RDCLADVDTKPAHQNLRQKVDNFV<ATHLDKQEWNPT |
| Parental | MNKNQLRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFLAAKKKEAVPAPPPEPESQ |
| .NK.QLRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFLAAKKKEAVPAPPPEPESQ | |
| Retrocopy | VNKKQLRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFLAAKKKEAVPAPPPEPESQ |
| Parental | DPPAPSQDAS |
| DPPAPSQDAS | |
| Retrocopy | DPPAPSQDAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 2 .23 RPM | 12 .05 RPM |
| SRP017611_brain | 2 .86 RPM | 8 .89 RPM |
| SRP017611_kidney | 2 .25 RPM | 7 .66 RPM |
| SRP017611_liver | 0 .36 RPM | 3 .48 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000034598 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000016776 | 1 retrocopy |
retro_cfam_1374 ,
|
| Callithrix jacchus | ENSCJAG00000031971 | 4 retrocopies | |
| Homo sapiens | ENSG00000145919 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010925 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000002626 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013793 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000044502 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000476 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000014283 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001107 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000016057 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000017544 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000013505 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014046 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000007617 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000384 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000004260 | 1 retrocopy |