RetrogeneDB ID: | retro_mdom_455 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:634813146..634813380(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LAMTOR3 | ||
| Ensembl ID: | ENSMODG00000020688 | ||
| Aliases: | None | ||
| Description: | late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 [Source:HGNC Symbol;Acc:15606] |
| Percent Identity: | 71.25 % |
| Parental protein coverage: | 62.9 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | PAFLSTFALATDQGSKLGLSKN-KSIICYYNTYQVVQFNRLPLVV-SFIASSSANTGLIVSLEKELAPLF |
| P.FL.TFA.AT.Q.SKLGL.KN.KSIIC.YNTY.V.QFNR.PLV...FI.SSS.N.G....LEKEL.PLF | |
| Retrocopy | PDFLFTFAYATGQESKLGLPKN>KSIICHYNTYHVIQFNR*PLVA<NFIVSSSTNFGQTFCLEKELVPLF |
| Parental | EELRQVVEGS |
| EEL.QVVEGS | |
| Retrocopy | EELKQVVEGS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .12 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |