RetrogeneDB ID: | retro_etel_1621 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_283533:7511..7721(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LAMTOR3 | ||
| Ensembl ID: | ENSETEG00000009065 | ||
| Aliases: | None | ||
| Description: | late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 [Source:HGNC Symbol;Acc:15606] |
| Percent Identity: | 57.14 % |
| Parental protein coverage: | 56.45 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MADDLKRFLYKKLPXXXXXXXXXXXXXXXXXFIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKS |
| .ADDL.RFLY.K.P..................IK.AND.APE.ALRP.FLST.ALA.D.GSKLGLS.NKS | |
| Retrocopy | VADDLQRFLYEKAPSVEGHHTIVISDRDGAPVIKAANDDAPEPALRPDFLSTSALAIDRGSKLGLSGNKS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |