RetrogeneDB ID: | retro_mdom_1094 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 3:82629519..82629960(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPS15 | ||
| Ensembl ID: | ENSMODG00000017813 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein S15 [Source:HGNC Symbol;Acc:14504] |
| Percent Identity: | 63.51 % |
| Parental protein coverage: | 60.91 % |
| Number of stop codons detected: | 6 |
| Number of frameshifts detected: | 0 |
| Parental | LSLEMANQKEKMKIKTEQLLNKMLINPEDTKSLEARVTRLTVKIHNYEEHMQKHRKDKAHKRWLLMSIDQ |
| LSLEM..QK.KMKIK.E.LLNKM.INPED.KSLE..VTRL.VKI.NYEEH.Q...KDK.HK..LLMSI.Q | |
| Retrocopy | LSLEMVSQKMKMKIKNEKLLNKMSINPEDIKSLEV*VTRLIVKIQNYEEHLQTQCKDKFHK*YLLMSI-Q |
| Parental | RKKLLKKLRQTNFEVFEKICKDLNIEYTIPPRYNQPTHRRWMAKKAFCIKVFQEKQKLKKLKKQEAELKN |
| RKKL.KKL..TN.EVFEK.C..L.I.YT.PP.YN.P.H....AKKA.C..VFQE.QKLK..KK.....K. | |
| Retrocopy | RKKLFKKLLWTNSEVFEKTCNYLDI*YTFPPQYNLPVHQW*VAKKALCVMVFQEAQKLKLKKK*H*NVKK |
| Parental | KETKKPKS |
| ......KS | |
| Retrocopy | QRSQSQKS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001463 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000030390 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001852 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000010877 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000007581 | 1 retrocopy | |
| Felis catus | ENSFCAG00000005265 | 1 retrocopy | |
| Homo sapiens | ENSG00000116898 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006475 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017813 | 1 retrocopy |
retro_mdom_1094 ,
|
| Mus musculus | ENSMUSG00000028861 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011467 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000002656 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001537 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000000541 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000026393 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000608 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000000958 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000008948 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000002345 | 1 retrocopy |