RetrogeneDB ID: retro_fcat_792

Retrocopy location

• Organism: Cat (Felis catus)
• Coordinates: B2:115803931..115804175(-)
• Located in intron of: None

Retrocopy information

• Ensembl ID: None
• Aliases: None
• Status: NOVEL

Parental gene information

• Parental gene symbol: RPS11
• Ensembl ID: ENSFCAG00000009196
• Aliases: None
• Description: ribosomal protein S11 [Source:HGNC Symbol;Acc:10384]

Sequence

>retro_fcat_792
CAGGATACCTTTAAGGGAACCTATATTGGCAGGAAATTCTCTTTTCTGCTAACGTCTCCATCAGAGGATGGATTCCGTCT
GGCTTGGTGACCAAAGCGAAGATGTAGAGGGTAACTGTCATCTAATGAGACTACCTCCACTATGTCCAAAAGTACAACTG
CTTTGAGAAATGTCACAAGAACAAGTCCGTGCACATGTTCCCAGCTTCGGAGATGTCAAGATTGGCAACACTGTCACAGT
GGGT

Alignment

ORF - retro_fcat_792 Open Reading Frame is not conserved.

Retrocopy - Parental Gene Alignment summary:

• Percent Identity: 59.52 %
• Parental protein coverage: 51.9 %
• Number of stop codons detected: 3
• Number of frameshifts detected: 2

Retrocopy - Parental Gene Alignment:

Parental  KEAIEGTYIDKKCPF-TGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPC
          .....GTYI..K..F...NVSIRG.I.SG.VTK.KM.R..VI..DYLHY..KYN.FEK.HKN.SVH..P.
Retrocopy QDTFKGTYIGRKFSF<SANVSIRGWIPSGLVTKAKM*RVTVI**DYLHYVQKYNCFEKCHKNKSVHMFPA

Parental  -FRDVQIGDIVTVG
          .F.DV.IG..VTVG
Retrocopy <FGDVKIGNTVTVG

Legend:

• *: Stop codon
• >: Forward frameshift by one nucleotide
• <: Reverse frameshift by one nucleotide

Expression

RNA-Seq

Expression validation based on RNA-Seq data:

Library	Retrocopy expression	Parental gene expression
SRP017611_brain	0.00 RPM	123.04 RPM
SRP017611_kidney	0.00 RPM	501.27 RPM
SRP017611_liver	0.00 RPM	210.87 RPM

ChIP-Seq

Felis catus was not studied using ChIP-Seq data.

EST

No EST(s) were mapped for retro_fcat_792 retrocopy.

TSS

Felis catus was not studied using FANTOM5 data.

Lab

retro_fcat_792 was not experimentally validated.

Homology

Retrocopy orthology:

Felis catus does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.

---

Parental genes homology:

Parental genes homology involve 21 parental genes, and 128 retrocopies.

Species	Parental gene accession	Retrocopies number
Canis familiaris	ENSCAFG00000003631	9 retrocopies	retro_cfam_126, retro_cfam_1333, retro_cfam_1572, retro_cfam_1656, retro_cfam_1669, retro_cfam_1900, retro_cfam_1955, retro_cfam_2121, retro_cfam_248,
Danio rerio	ENSDARG00000053058	1 retrocopy	retro_drer_15,
Dasypus novemcinctus	ENSDNOG00000016107	9 retrocopies	retro_dnov_1055, retro_dnov_1102, retro_dnov_1629, retro_dnov_1729, retro_dnov_188, retro_dnov_2520, retro_dnov_586, retro_dnov_68, retro_dnov_754,
Dipodomys ordii	ENSDORG00000012195	1 retrocopy	retro_dord_635,
Equus caballus	ENSECAG00000000370	1 retrocopy	retro_ecab_868,
Felis catus	ENSFCAG00000009196	13 retrocopies	retro_fcat_1362, retro_fcat_1491, retro_fcat_1535, retro_fcat_1564, retro_fcat_1719, retro_fcat_1945, retro_fcat_197, retro_fcat_1991, retro_fcat_273, retro_fcat_507, retro_fcat_792 , retro_fcat_854, retro_fcat_995,
Gorilla gorilla	ENSGGOG00000002936	6 retrocopies	retro_ggor_1525, retro_ggor_2843, retro_ggor_2900, retro_ggor_292, retro_ggor_805, retro_ggor_842,
Macropus eugenii	ENSMEUG00000008649	2 retrocopies	retro_meug_1176, retro_meug_1640,
Microcebus murinus	ENSMICG00000002542	8 retrocopies	retro_mmur_1278, retro_mmur_1317, retro_mmur_186, retro_mmur_295, retro_mmur_430, retro_mmur_452, retro_mmur_812, retro_mmur_820,
Myotis lucifugus	ENSMLUG00000030475	1 retrocopy	retro_mluc_539,
Macaca mulatta	ENSMMUG00000007549	6 retrocopies	retro_mmul_1147, retro_mmul_1856, retro_mmul_2464, retro_mmul_413, retro_mmul_634, retro_mmul_813,
Monodelphis domestica	ENSMODG00000013434	7 retrocopies	retro_mdom_1185, retro_mdom_1284, retro_mdom_1421, retro_mdom_1950, retro_mdom_636, retro_mdom_922, retro_mdom_978,
Mus musculus	ENSMUSG00000003429	16 retrocopies	retro_mmus_1738, retro_mmus_2230, retro_mmus_2255, retro_mmus_2322, retro_mmus_2486, retro_mmus_2854, retro_mmus_3048, retro_mmus_3051, retro_mmus_3060, retro_mmus_3342, retro_mmus_398, retro_mmus_404, retro_mmus_714, retro_mmus_754, retro_mmus_842, retro_mmus_860,
Otolemur garnettii	ENSOGAG00000004627	7 retrocopies	retro_ogar_1290, retro_ogar_1813, retro_ogar_1910, retro_ogar_2037, retro_ogar_2573, retro_ogar_2640, retro_ogar_840,
Pelodiscus sinensis	ENSPSIG00000011089	1 retrocopy	retro_psin_35,
Pan troglodytes	ENSPTRG00000011299	1 retrocopy	retro_ptro_88,
Rattus norvegicus	ENSRNOG00000020595	18 retrocopies	retro_rnor_1132, retro_rnor_1159, retro_rnor_1261, retro_rnor_1299, retro_rnor_1363, retro_rnor_1414, retro_rnor_1435, retro_rnor_1451, retro_rnor_1635, retro_rnor_1790, retro_rnor_2000, retro_rnor_2647, retro_rnor_385, retro_rnor_394, retro_rnor_538, retro_rnor_737, retro_rnor_835, retro_rnor_989,
Sarcophilus harrisii	ENSSHAG00000004991	1 retrocopy	retro_shar_649,
Sus scrofa	ENSSSCG00000003165	2 retrocopies	retro_sscr_432, retro_sscr_887,
Ictidomys tridecemlineatus	ENSSTOG00000023443	2 retrocopies	retro_itri_1033, retro_itri_805,
Tupaia belangeri	ENSTBEG00000016677	16 retrocopies	retro_tbel_125, retro_tbel_1361, retro_tbel_1753, retro_tbel_2071, retro_tbel_2207, retro_tbel_2808, retro_tbel_2947, retro_tbel_319, retro_tbel_3401, retro_tbel_3571, retro_tbel_3600, retro_tbel_3742, retro_tbel_449, retro_tbel_604, retro_tbel_801, retro_tbel_836,