RetrogeneDB ID: | retro_mmul_634 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 10:44632142..44632479(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.9891 | ||
| Ensembl ID: | ENSMMUG00000007549 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S11 [Source:RefSeq peptide;Acc:NP_001182683] |
| Percent Identity: | 64.04 % |
| Parental protein coverage: | 71.52 % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected: | 1 |
| Parental | MADIQTERAYQKQPTI-FQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTGNVSIR |
| .ADI.TE..YQKQ.TI.F..KK..LL..TG.EKLPR.YKNIGLGFKTPK...EGT..D.K.PFTG..SI. | |
| Retrocopy | IADIKTE*GYQKQTTI>FKTKK-FLLRDTGNEKLPR*YKNIGLGFKTPKKDTEGT*TDEKFPFTGSISI* |
| Parental | GRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHL |
| .RILSG.V.KM..QRTI.I..DYLHY..K.N...K.H.NM.VHL | |
| Retrocopy | ERILSGMVNKMNSQRTIIICPDYLHYMSKCNCV*KCHENMPVHL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 78 .55 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 171 .67 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 62 .38 RPM |
| SRP007412_heart | 0 .00 RPM | 153 .04 RPM |
| SRP007412_kidney | 0 .00 RPM | 127 .58 RPM |
| SRP007412_liver | 0 .00 RPM | 198 .71 RPM |
| SRP007412_testis | 0 .00 RPM | 99 .40 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2449 |
| Gorilla gorilla | retro_ggor_1525 |
| Pongo abelii | retro_pabe_1800 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014020 | 13 retrocopies | |
| Bos taurus | ENSBTAG00000013924 | 5 retrocopies | |
| Canis familiaris | ENSCAFG00000003631 | 9 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000069 | 1 retrocopy | |
| Danio rerio | ENSDARG00000053058 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000016107 | 9 retrocopies | |
| Equus caballus | ENSECAG00000000370 | 1 retrocopy | |
| Felis catus | ENSFCAG00000009196 | 13 retrocopies | |
| Gorilla gorilla | ENSGGOG00000002936 | 6 retrocopies | |
| Myotis lucifugus | ENSMLUG00000030475 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007549 | 6 retrocopies | |
| Monodelphis domestica | ENSMODG00000013434 | 7 retrocopies | |
| Otolemur garnettii | ENSOGAG00000004627 | 7 retrocopies | |
| Pan troglodytes | ENSPTRG00000011299 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000020595 | 18 retrocopies | |
| Sorex araneus | ENSSARG00000003236 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000003165 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000023443 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000016677 | 16 retrocopies |