RetrogeneDB ID: | retro_dnov_490 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_5238:81626..81839(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HSPE1 | ||
| Ensembl ID: | ENSDNOG00000013246 | ||
| Aliases: | None | ||
| Description: | heat shock 10kDa protein 1 (chaperonin 10) [Source:HGNC Symbol;Acc:5269] |
| Percent Identity: | 85.92 % |
| Parental protein coverage: | 70.3 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MLPEKSQGKVLQATVVAVGSGSKGKSGDIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYI |
| .LPEKSQGKVLQAT.VAVG.GSKGK.GDI.PVSVKVGDKVLLPEYGGTKVV.DD.DYFLFR.GDILGK.. | |
| Retrocopy | LLPEKSQGKVLQATAVAVGLGSKGKDGDI*PVSVKVGDKVLLPEYGGTKVVRDDMDYFLFRGGDILGKCV |
| Parental | D |
| D | |
| Retrocopy | D |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 58 .34 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 20 .90 RPM |
| SRP012922_heart | 0 .00 RPM | 31 .56 RPM |
| SRP012922_kidney | 0 .00 RPM | 108 .70 RPM |
| SRP012922_liver | 0 .00 RPM | 78 .02 RPM |
| SRP012922_lung | 0 .00 RPM | 35 .43 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 30 .46 RPM |
| SRP012922_spleen | 0 .00 RPM | 62 .84 RPM |