RetrogeneDB ID: | retro_ptro_2847 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 9:90821246..90821508(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HSPE1 | ||
| Ensembl ID: | ENSPTRG00000012774 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 74.16 % |
| Parental protein coverage: | 86.27 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | RVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLD |
| ..LVERSAAETVTKG.I.LPEKS.GKVLQA.VVA.G.G.KGKGGEIQPVS.KV..K...PEYG.TK.VLD | |
| Retrocopy | QILVERSAAETVTKGDIRLPEKSKGKVLQAIVVAAG*GYKGKGGEIQPVSMKVKNK-FPPEYGDTKIVLD |
| Parental | DKDYFLFRD-GDILGKYVD |
| DKD..L.RD..DIL.KYVD | |
| Retrocopy | DKDCILLRD>ADILEKYVD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 33 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 43 .05 RPM |
| SRP007412_heart | 0 .00 RPM | 125 .59 RPM |
| SRP007412_kidney | 0 .00 RPM | 129 .40 RPM |
| SRP007412_liver | 0 .00 RPM | 156 .86 RPM |
| SRP007412_testis | 0 .00 RPM | 45 .63 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4194 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000013246 | 27 retrocopies |
retro_dnov_1088, retro_dnov_1117, retro_dnov_1214, retro_dnov_1375, retro_dnov_1391, retro_dnov_1405, retro_dnov_1412, retro_dnov_1428, retro_dnov_1445, retro_dnov_1546, retro_dnov_1647, retro_dnov_1652, retro_dnov_1686, retro_dnov_1821, retro_dnov_2176, retro_dnov_2291, retro_dnov_2413, retro_dnov_2569, retro_dnov_2625, retro_dnov_2652, retro_dnov_418, retro_dnov_481, retro_dnov_483, retro_dnov_490, retro_dnov_524, retro_dnov_554, retro_dnov_966,
|
| Macaca mulatta | ENSMMUG00000010491 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025876 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000012774 | 17 retrocopies | |
| Sus scrofa | ENSSSCG00000016078 | 7 retrocopies |