RetrogeneDB ID: | retro_dnov_2160 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_51746:771..1005(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL36 | ||
| Ensembl ID: | ENSDNOG00000005163 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L36 [Source:HGNC Symbol;Acc:13631] |
| Percent Identity: | 82.05 % |
| Parental protein coverage: | 74.29 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | HKVTKNVSKPRHSRRRGXLTKHTKFVRDMIREVCDFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAK |
| .K.T.N.SKPRHSRR.G.LTK.TKF..DMIREVC.F.PYE.RAMELL.VSKDK.ALKFIKKRVGTHIRAK | |
| Retrocopy | NKATRNTSKPRHSRRLGCLTKRTKFM*DMIREVCGFTPYEQRAMELLEVSKDKHALKFIKKRVGTHIRAK |
| Parental | RKREELSN |
| RKREELSN | |
| Retrocopy | RKREELSN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 334 .48 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 114 .51 RPM |
| SRP012922_heart | 0 .00 RPM | 160 .33 RPM |
| SRP012922_kidney | 0 .00 RPM | 292 .69 RPM |
| SRP012922_liver | 0 .00 RPM | 167 .97 RPM |
| SRP012922_lung | 0 .15 RPM | 361 .35 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 181 .22 RPM |
| SRP012922_spleen | 0 .11 RPM | 430 .49 RPM |