RetrogeneDB ID: | retro_sscr_960 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 8:10946812..10947054(+) | ||
| Located in intron of: | ENSSSCG00000008745 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL36 | ||
| Ensembl ID: | ENSSSCG00000030010 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L36 [Source:HGNC Symbol;Acc:13631] |
| Percent Identity: | 56.1 % |
| Parental protein coverage: | 77.14 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | AVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRA-LKFIKKR |
| AV.L.........V.KPR.....G.LTKHTK...D.I.EVC.F...ERRA.E.LKVS.D..A.LKFI.K. | |
| Retrocopy | AVALGSPAALGHKVGKPRQGHHCGHLTKHTKVMQDVIQEVCHFVTNERRAKERLKVSEDRWA<LKFIEKS |
| Parental | VGTHIRAKRKRE |
| VGTHI.AK.KRE | |
| Retrocopy | VGTHIHAKGKRE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 193 .12 RPM |
| SRP014902_testis | 0 .00 RPM | 515 .29 RPM |
| SRP018288_heart | 0 .00 RPM | 164 .23 RPM |
| SRP018288_kidney | 0 .00 RPM | 193 .27 RPM |
| SRP018288_liver | 0 .00 RPM | 179 .42 RPM |
| SRP018288_lung | 0 .00 RPM | 352 .62 RPM |
| SRP018856_adipose | 0 .00 RPM | 288 .10 RPM |
| SRP035408_brain | 0 .00 RPM | 198 .53 RPM |
| SRP035408_liver | 0 .00 RPM | 186 .64 RPM |