RetrogeneDB ID: | retro_dnov_1916 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_36445:51604..51819(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000004481 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.49 % |
| Parental protein coverage: | 54.14 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | LTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGP-N |
| LTTLEVAG.MLGGK..GSL...GKVR.QTPKVAKQE...KK.G.AK..MQYN...VN....FGKKK.P.N | |
| Retrocopy | LTTLEVAGHMLGGKIRGSLVCVGKVRSQTPKVAKQEEENKKRGQAK*HMQYNWHLVNAIVIFGKKKDP<N |
| Parental | ANS |
| ANS | |
| Retrocopy | ANS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .78 RPM | 470 .42 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 510 .15 RPM |
| SRP012922_heart | 0 .23 RPM | 365 .68 RPM |
| SRP012922_kidney | 0 .27 RPM | 655 .47 RPM |
| SRP012922_liver | 0 .31 RPM | 270 .14 RPM |
| SRP012922_lung | 0 .46 RPM | 1025 .85 RPM |
| SRP012922_quadricep_muscle | 0 .17 RPM | 430 .29 RPM |
| SRP012922_spleen | 0 .46 RPM | 1168 .42 RPM |