RetrogeneDB ID: | retro_ecab_149 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 1:139456092..139456326(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FAU | ||
| Ensembl ID: | ENSECAG00000021956 | ||
| Aliases: | None | ||
| Description: | ubiquitin-like protein fubi and ribosomal protein S30 [Source:RefSeq peptide;Acc:NP_001157337] |
| Percent Identity: | 79.52 % |
| Parental protein coverage: | 58.16 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | QCGVEA-LTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVSESVAKQEKKKKKTGRAKRRMQYNRRFVNVV |
| QCGVEA.LTTLEVA..MLGG.VHGSLA.AGKVRGQTPK....VAKQE.KK..TG.AK..MQYNR.FVN.V | |
| Retrocopy | QCGVEAALTTLEVATCMLGGEVHGSLATAGKVRGQTPK----VAKQEEKKE-TGQAKQWMQYNRHFVNIV |
| Parental | PTFGKKKGPNANS |
| PTFGKKKGPNANS | |
| Retrocopy | PTFGKKKGPNANS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 466 .93 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 250 .31 RPM |
| SRP021940_embryo | 0 .00 RPM | 336 .28 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 203 .13 RPM |
| SRP021940_synovial_membrane | 0 .03 RPM | 271 .78 RPM |
| SRP021940_testis | 0 .06 RPM | 213 .76 RPM |