RetrogeneDB ID: | retro_cjac_686 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 10:50277985..50278186(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000006254 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CYB5A | ||
| Ensembl ID: | ENSCJAG00000003163 | ||
| Aliases: | None | ||
| Description: | cytochrome b5 type A (microsomal) [Source:HGNC Symbol;Acc:2570] |
Retrocopy-Parental alignment summary:
>retro_cjac_686
GAGGCTATCATGCACTCTACGGATGCTAGAGAATTGTTCAAAACATATATCACTCGGGGCATTTATCCAGATGACAGATC
AATCACAAATCTTTCAGAAACTCTTTTTACCACTGTTGATTCTCCCTCTAATTAGTGGACCAATTGGGTGATCCCAGCCA
GCTCAGCACTGACCACCCTCAGATATCACCTCTACGTGGCC
ORF - retro_cjac_686 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 60.87 % |
| Parental protein coverage: | 51.49 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | EDVGHSTDARELSKTYIIGELHPDDRPKLNKPSETLITTVDSSSSWWTNWVIPGISAVAVALMYRLYMA |
| E...HSTDAREL.KTYI.....PDDR...N..SETL.TTVDS.S..WTNWVIP..SA....L.Y.LY.A | |
| Retrocopy | EAIMHSTDARELFKTYITRGIYPDDRSITNL-SETLFTTVDSPSN*WTNWVIPASSAL-TTLRYHLYVA |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 16 .86 RPM |
| SRP051959_heart | 0 .00 RPM | 14 .56 RPM |
| SRP051959_kidney | 0 .00 RPM | 131 .34 RPM |
| SRP051959_liver | 0 .00 RPM | 241 .17 RPM |
| SRP051959_lung | 0 .00 RPM | 16 .37 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 5 .87 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 7 .49 RPM |
| SRP051959_spleen | 0 .00 RPM | 15 .17 RPM |
Callithrix jacchus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_cjac_686 retrocopy.
Callithrix jacchus was not studied using FANTOM5 data.
retro_cjac_686 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_cjac_686 has 4 orthologous retrocopies within eutheria group .| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1307 |
| Pan troglodytes | retro_ptro_898 |
| Pongo abelii | retro_pabe_1094 |
| Macaca mulatta | retro_mmul_2162 |