RetrogeneDB ID: | retro_ptro_898 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 14:25060266..25060471(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CYB5A | ||
| Ensembl ID: | ENSPTRG00000010111 | ||
| Aliases: | None | ||
| Description: | cytochrome b5 type A (microsomal) [Source:HGNC Symbol;Acc:2570] |
| Percent Identity: | 68.57 % |
| Parental protein coverage: | 51.49 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | EDVGHSTDAREMSKTFIIGE-LHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMA |
| ED..HSTDA.E.SKT.IIG..L.PDDR...N...ETL.TT.DS.SS.WTNWVIPAISA..VAL.Y.LYMA | |
| Retrocopy | EDIMHSTDATELSKTYIIGG>LYPDDRSITNLS-ETLFTTVDSHSS*WTNWVIPAISALTVALRYHLYMA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 14 .76 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 12 .91 RPM |
| SRP007412_heart | 0 .00 RPM | 18 .01 RPM |
| SRP007412_kidney | 0 .00 RPM | 290 .13 RPM |
| SRP007412_liver | 0 .00 RPM | 357 .62 RPM |
| SRP007412_testis | 0 .00 RPM | 19 .39 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1307 |
| Pongo abelii | retro_pabe_1094 |
| Macaca mulatta | retro_mmul_2162 |
| Callithrix jacchus | retro_cjac_686 |