RetrogeneDB ID: | retro_btau_1505 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 6:97797183..97797376(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HBXIP | ||
| Ensembl ID: | ENSBTAG00000014970 | ||
| Aliases: | LAMTOR5, HBXIP | ||
| Description: | Hepatitis B virus X-interacting protein homolog [Source:UniProtKB/Swiss-Prot;Acc:Q3SZ68] |
| Percent Identity: | 65.67 % |
| Parental protein coverage: | 71.43 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCR-GTLSDEHAG-VISVLAQQAAKLTSDPTDIPVV |
| ME..LEQH.ED.MK.PS...VL.T.SQG..LGC..GTL.DEHA..VI.VLAQ.AAKLTSD.T...VV | |
| Retrocopy | MEMALEQHPEDAMKEPSTAEVL*TGSQGFSLGCL<GTL*DEHAT<VIPVLAQPAAKLTSDLTGVLVV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 24 .37 RPM |
| ERP005899_muscle | 0 .05 RPM | 24 .49 RPM |
| SRP017611_brain | 0 .05 RPM | 19 .60 RPM |
| SRP017611_kidney | 0 .00 RPM | 38 .41 RPM |
| SRP017611_liver | 0 .00 RPM | 13 .74 RPM |
| SRP030211_testis | 0 .00 RPM | 19 .39 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Sus scrofa | retro_sscr_986 |