RetrogeneDB ID: | retro_fcat_478 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | A3:69297338..69297549(-) | ||
| Located in intron of: | ENSFCAG00000013448 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LAMTOR5 | ||
| Ensembl ID: | ENSFCAG00000023792 | ||
| Aliases: | None | ||
| Description: | late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 [Source:HGNC Symbol;Acc:17955] |
| Percent Identity: | 83.56 % |
| Parental protein coverage: | 78.02 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | VLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAA-KLTSDPTDIPVVCLESDNGNIMIQKHDSITVAV-HK |
| VLCT.SQGLNLGC.GTLSDEHAGV.S.LAQQ.A..LTSDPTD.PVV.LESDNGNIMIQK.D.ITVAV.HK | |
| Retrocopy | VLCTGSQGLNLGCHGTLSDEHAGVLSILAQQVA<ELTSDPTDTPVVRLESDNGNIMIQKQDRITVAV<HK |
| Parental | MAS |
| MAS | |
| Retrocopy | MAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 15 .84 RPM |
| SRP017611_kidney | 0 .00 RPM | 31 .43 RPM |
| SRP017611_liver | 0 .00 RPM | 11 .42 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011504 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000014970 | 3 retrocopies | |
| Felis catus | ENSFCAG00000023792 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000015023 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000006807 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003401 | 5 retrocopies |