RetrogeneDB ID: | retro_amel_1110 | ||
Retrocopy location | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL192913.1:79373..79768(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | OSTC | ||
| Ensembl ID: | ENSAMEG00000001753 | ||
| Aliases: | None | ||
| Description: | oligosaccharyltransferase complex subunit (non-catalytic) [Source:HGNC Symbol;Acc:24448] |
| Percent Identity: | 51.43 % |
| Parental protein coverage: | 90.67 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | LVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIY-DVIVEPPSVGSMTDEHGHQRPVAFLAYR |
| L.L.CP.L.L...P.......M.V.AL.V.S.FLI.GG....DV....PSVGS..DE.G.QRP.AF.AYR | |
| Retrocopy | LGLDCPDLRLRSHPGCRV---MIV*ALEVGSGFLIRGGTLM<DVVAQLPSVGSVSDECGCQRPAAFVAYR |
| Parental | VNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIP---KLNRFLLLFIGFVCVLLSFFMASRVFKRMKLP |
| VNGQ.I.EG.ASSFLFT.G.............N.P...K..RF.LLFIG..CV.L..FMA.R.F..M.LP | |
| Retrocopy | VNGQDI-EGFASSFLFTVGSWE-LLFHKPGPSNAPNVPKCSRF-LLFIGLICVRLVSFMA-RPFVTMNLP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001753 | 2 retrocopies |
retro_amel_1110 , retro_amel_165,
|
| Canis familiaris | ENSCAFG00000011286 | 12 retrocopies | |
| Callithrix jacchus | ENSCJAG00000016002 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000024467 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000003717 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000026873 | 6 retrocopies | |
| Monodelphis domestica | ENSMODG00000020599 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000008869 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000041084 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000011056 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000005915 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000023322 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000009145 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000021644 | 6 retrocopies | |
| Tarsius syrichta | ENSTSYG00000000724 | 2 retrocopies |