RetrogeneDB ID: | retro_tsyr_1550 | ||
Retrocopylocation | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_48628:2020..2234(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSTSYG00000009556 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 74.32 % |
| Parental protein coverage: | 69.23 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | MIGDILLFG-TLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIRE-ILLSIRYFRIFIALWNVFMMFC |
| M.G.ILL.G.T.LMNAGA.LNFKLKKK..QGFGEES..PSTGDNIRE.IL.S..YF.IFI.L.N.FMMFC | |
| Retrocopy | MVGVILLLG<TPLMNAGAMLNFKLKKKGMQGFGEESCDPSTGDNIRE<ILMSLGYFGIFISL*NGFMMFC |
| Parental | MIVL |
| .IVL | |
| Retrocopy | VIVL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010105 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000015643 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013936 | 1 retrocopy | |
| Equus caballus | ENSECAG00000026861 | 1 retrocopy | |
| Felis catus | ENSFCAG00000016411 | 1 retrocopy | |
| Homo sapiens | ENSG00000214046 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000044600 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005569 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009694 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010650 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042037 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013863 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009556 | 1 retrocopy |
retro_tsyr_1550 ,
|
| Tursiops truncatus | ENSTTRG00000015020 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000006699 | 1 retrocopy |