RetrogeneDB ID: | retro_fcat_934 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | B3:136204626..136204783(-) | ||
| Located in intron of: | ENSFCAG00000015048 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000016411 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.49 % |
| Parental protein coverage: | 69.33 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | LLFGTLLMNAGAVLNFKLKKKDT-QGFGEESREPSTGDNIREFLLSLRYFRIF |
| LL...LLMNA...LNFK.K..D..QGFGEES..PST..NI.EFL.S.R.F... | |
| Retrocopy | LLLWMLLMNARVALNFK*KRTDN>QGFGEESG*PSTAGNIQEFLWSFRCFSLY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 9 .64 RPM |
| SRP017611_kidney | 0 .00 RPM | 11 .23 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .26 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010105 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000015643 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013936 | 1 retrocopy | |
| Equus caballus | ENSECAG00000026861 | 1 retrocopy | |
| Felis catus | ENSFCAG00000016411 | 1 retrocopy |
retro_fcat_934 ,
|
| Homo sapiens | ENSG00000214046 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000044600 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005569 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009694 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010650 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042037 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013863 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009556 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015020 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000006699 | 1 retrocopy |